IMPA2 Blocking Peptide (33R-7934)

A synthetic peptide for use as a blocking control in assays to test for specificity of IMPA2 antibody, catalog no. 70R-2599

Synonyms IMPA2 control peptide, IMPA2 antibody Blocking Peptide, Anti-IMPA2 Blocking Peptide, Inositol Blocking Peptide, Myo-1 Blocking Peptide, IMPA Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors