IMPA2 Blocking Peptide (33R-7934)
A synthetic peptide for use as a blocking control in assays to test for specificity of IMPA2 antibody, catalog no. 70R-2599
Overview
Overview
| Synonyms | IMPA2 control peptide, IMPA2 antibody Blocking Peptide, Anti-IMPA2 Blocking Peptide, Inositol Blocking Peptide, Myo-1 Blocking Peptide, IMPA Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product