IMPDH1 Blocking Peptide (33R-4468)
A synthetic peptide for use as a blocking control in assays to test for specificity of IMPDH1 antibody, catalog no. 70R-2055
Overview
Overview
| Synonyms | IMPDH1 control peptide, IMPDH1 antibody Blocking Peptide, Anti-IMPDH1 Blocking Peptide, Imp Blocking Peptide, Inosine Monophosphate Dehydrogenase 1 Blocking Peptide, DKFZp781N0678 Blocking Peptide, IMPD Blocking Peptide, IMPD1 Blocking Peptide, LCA11 Blocking Peptide, RP10 Blocking Peptide, sWSS2608 Blocking Peptide, IMPDH1, IMPDH-1, IMPDH 1, IMPDH-1 Blocking Peptide, IMPDH 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE |
|---|---|
| Molecular Weight | 62 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product