IMPDH1 Blocking Peptide (33R-4468)

A synthetic peptide for use as a blocking control in assays to test for specificity of IMPDH1 antibody, catalog no. 70R-2055

Synonyms IMPDH1 control peptide, IMPDH1 antibody Blocking Peptide, Anti-IMPDH1 Blocking Peptide, Imp Blocking Peptide, Inosine Monophosphate Dehydrogenase 1 Blocking Peptide, DKFZp781N0678 Blocking Peptide, IMPD Blocking Peptide, IMPD1 Blocking Peptide, LCA11 Blocking Peptide, RP10 Blocking Peptide, sWSS2608 Blocking Peptide, IMPDH1, IMPDH-1, IMPDH 1, IMPDH-1 Blocking Peptide, IMPDH 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE
Molecular Weight 62 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IMPDH1 acts as a homotetramer to regulate cell growth. It is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors