IMPDH2 Blocking Peptide (33R-8336)
A synthetic peptide for use as a blocking control in assays to test for specificity of IMPDH2 antibody, catalog no. 70R-2137
Overview
Overview
| Synonyms | IMPDH2 control peptide, IMPDH2 antibody Blocking Peptide, Anti-IMPDH2 Blocking Peptide, Imp Blocking Peptide, Inosine Monophosphate Dehydrogenase 2 Blocking Peptide, IMPD2 Blocking Peptide, IMPDH-II Blocking Peptide, IMPDH2, IMPDH-2, IMPDH 2, IMPDH-2 Blocking Peptide, IMPDH 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF |
|---|---|
| Molecular Weight | 56 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product