IMPDH2 Blocking Peptide (33R-8336)

A synthetic peptide for use as a blocking control in assays to test for specificity of IMPDH2 antibody, catalog no. 70R-2137

Synonyms IMPDH2 control peptide, IMPDH2 antibody Blocking Peptide, Anti-IMPDH2 Blocking Peptide, Imp Blocking Peptide, Inosine Monophosphate Dehydrogenase 2 Blocking Peptide, IMPD2 Blocking Peptide, IMPDH-II Blocking Peptide, IMPDH2, IMPDH-2, IMPDH 2, IMPDH-2 Blocking Peptide, IMPDH 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors