INADL antibody (70R-5773)

Rabbit polyclonal INADL antibody

Synonyms Polyclonal INADL antibody, Anti-INADL antibody, Cipp antibody, PATJ antibody, Inad-Like antibody, FLJ26982 antibody
Cross Reactivity Human
Applications WB
Immunogen INADL antibody was raised using a synthetic peptide corresponding to a region with amino acids EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSG
Assay Information INADL Blocking Peptide, catalog no. 33R-2804, is also available for use as a blocking control in assays to test for specificity of this INADL antibody

Images

Western Blot analysis using INADL antibody (70R-5773)

INADL antibody (70R-5773) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 196 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of INADL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance INADL is a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using INADL antibody (70R-5773) | INADL antibody (70R-5773) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors