Inhibin Alpha antibody (70R-5692)

Rabbit polyclonal Inhibin Alpha antibody raised against the N terminal of INHA

Synonyms Polyclonal Inhibin Alpha antibody, Anti-Inhibin Alpha antibody, INHA antibody
Specificity Inhibin Alpha antibody was raised against the N terminal of INHA
Cross Reactivity Human
Applications WB
Immunogen Inhibin Alpha antibody was raised using the N terminal of INHA corresponding to a region with amino acids GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP
Assay Information Inhibin Alpha Blocking Peptide, catalog no. 33R-3384, is also available for use as a blocking control in assays to test for specificity of this Inhibin Alpha antibody

Images

Western Blot analysis using Inhibin Alpha antibody (70R-5692)

Inhibin Alpha antibody (70R-5692) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of INHA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance INHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Inhibin Alpha antibody (70R-5692) | Inhibin Alpha antibody (70R-5692) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors