IPP antibody (70R-4396)

Rabbit polyclonal IPP antibody raised against the C terminal of IPP

Synonyms Polyclonal IPP antibody, Anti-IPP antibody, Intracisternal A Particle-Promoted Polypeptide antibody, KLHL27 antibody
Specificity IPP antibody was raised against the C terminal of IPP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL
Assay Information IPP Blocking Peptide, catalog no. 33R-2592, is also available for use as a blocking control in assays to test for specificity of this IPP antibody


Western Blot analysis using IPP antibody (70R-4396)

IPP antibody (70R-4396) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IPP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IPP antibody (70R-4396) | IPP antibody (70R-4396) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors