IQCK antibody (70R-4181)

Rabbit polyclonal IQCK antibody raised against the middle region of IQCK

Synonyms Polyclonal IQCK antibody, Anti-IQCK antibody, MGC35048 antibody, FLJ20115 antibody, FLJ36575 antibody, Iq Motif Containing K antibody
Specificity IQCK antibody was raised against the middle region of IQCK
Cross Reactivity Human,Rat
Applications WB
Immunogen IQCK antibody was raised using the middle region of IQCK corresponding to a region with amino acids GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI
Assay Information IQCK Blocking Peptide, catalog no. 33R-3433, is also available for use as a blocking control in assays to test for specificity of this IQCK antibody


Western Blot analysis using IQCK antibody (70R-4181)

IQCK antibody (70R-4181) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IQCK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of IQC protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IQCK antibody (70R-4181) | IQCK antibody (70R-4181) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors