IRAK3 antibody (70R-5023)

Rabbit polyclonal IRAK3 antibody raised against the C terminal of IRAK3

Synonyms Polyclonal IRAK3 antibody, Anti-IRAK3 antibody, IL-1, Interleukin-1 Receptor-Associated Kinase 3 antibody, IL 1, IL1, IL 1 antibody, IL-1 antibody
Specificity IRAK3 antibody was raised against the C terminal of IRAK3
Cross Reactivity Human
Applications WB
Immunogen IRAK3 antibody was raised using the C terminal of IRAK3 corresponding to a region with amino acids NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
Assay Information IRAK3 Blocking Peptide, catalog no. 33R-6900, is also available for use as a blocking control in assays to test for specificity of this IRAK3 antibody

Images

Western Blot analysis using IRAK3 antibody (70R-5023)

IRAK3 antibody (70R-5023) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IRAK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IRAK3 antibody (70R-5023) | IRAK3 antibody (70R-5023) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors