IREB2 antibody (70R-4991)

Rabbit polyclonal IREB2 antibody raised against the middle region of IREB2

Synonyms Polyclonal IREB2 antibody, Anti-IREB2 antibody, IRP2AD antibody, ACO3 antibody, IREB-2 antibody, IREB 2 antibody, FLJ23381 antibody, IRP2 antibody, IREB-2, IREB2, Iron-Responsive Element Binding Protein 2 antibody, IREB 2
Specificity IREB2 antibody was raised against the middle region of IREB2
Cross Reactivity Human
Applications WB
Immunogen IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK
Assay Information IREB2 Blocking Peptide, catalog no. 33R-4113, is also available for use as a blocking control in assays to test for specificity of this IREB2 antibody


Western Blot analysis using IREB2 antibody (70R-4991)

IREB2 antibody (70R-4991) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IREB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IREB2 binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. IREB2 binds to the IRE element in ferritin which results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IREB2 antibody (70R-4991) | IREB2 antibody (70R-4991) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors