IRF6 antibody (70R-1620)

Rabbit polyclonal IRF6 antibody raised against the C terminal of IRF6

Synonyms Polyclonal IRF6 antibody, Anti-IRF6 antibody, OFC6 antibody, PPS antibody, Interferon Regulatory Factor 6 antibody, LPS antibody, IRF6, IRF-6 antibody, VWS antibody, IRF 6 antibody, IRF 6, PIT antibody, IRF-6
Specificity IRF6 antibody was raised against the C terminal of IRF6
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen IRF6 antibody was raised using the C terminal of IRF6 corresponding to a region with amino acids FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR
Assay Information IRF6 Blocking Peptide, catalog no. 33R-2986, is also available for use as a blocking control in assays to test for specificity of this IRF6 antibody


Western blot analysis using IRF6 antibody (70R-1620)

Recommended IRF6 Antibody Titration: 2.5ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IRF6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using IRF6 antibody (70R-1620) | Recommended IRF6 Antibody Titration: 2.5ug/ml

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors