RNF5 Blocking Peptide (33R-1002)

A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 70R-8548

Synonyms IRX3 control peptide, IRX3 antibody Blocking Peptide, Anti-IRX3 Blocking Peptide, iroquois homeobox 3 Blocking Peptide, IRX-1 Blocking Peptide, IRX3, IRX-3, IRX 3, IRX-3 Blocking Peptide, IRX 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAAFPHPHPAFYPYGQYQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPT
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IRX3 is a member of the Iroquois homeobox gene family that encodes a protein known for its essential role in spinal cord development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors