RNF5 Blocking Peptide (33R-1002)
A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 70R-8548
Overview
Overview
| Synonyms | IRX3 control peptide, IRX3 antibody Blocking Peptide, Anti-IRX3 Blocking Peptide, iroquois homeobox 3 Blocking Peptide, IRX-1 Blocking Peptide, IRX3, IRX-3, IRX 3, IRX-3 Blocking Peptide, IRX 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAAFPHPHPAFYPYGQYQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPT |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IRX3 is a member of the Iroquois homeobox gene family that encodes a protein known for its essential role in spinal cord development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product