Irx6 Blocking Peptide (33R-8033)
A synthetic peptide for use as a blocking control in assays to test for specificity of Irx6 antibody, catalog no. 70R-8750
Overview
Overview
| Synonyms | Irx6 control peptide, Irx6 antibody Blocking Peptide, Anti-Irx6 Blocking Peptide, iroquois homeobox 6 Blocking Peptide, RGD1564830 Blocking Peptide, Irx6, Irx-6, Irx 6, Irx-6 Blocking Peptide, Irx 6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLKKENKMTWVPKNKGGEERKADGGGEDALGCLNGDTKDATASQEAQGLQ |
|---|---|
| Molecular Weight | 47 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IRX6 is one Iroquois (Irx) proteins comprise a family of homeodomain-containing transcription factors involved in patterning and regionalization of embryonic tissues in both vertebrates and invertebrates. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product