Irx6 Blocking Peptide (33R-8033)

A synthetic peptide for use as a blocking control in assays to test for specificity of Irx6 antibody, catalog no. 70R-8750

Synonyms Irx6 control peptide, Irx6 antibody Blocking Peptide, Anti-Irx6 Blocking Peptide, iroquois homeobox 6 Blocking Peptide, RGD1564830 Blocking Peptide, Irx6, Irx-6, Irx 6, Irx-6 Blocking Peptide, Irx 6 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RLKKENKMTWVPKNKGGEERKADGGGEDALGCLNGDTKDATASQEAQGLQ
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IRX6 is one Iroquois (Irx) proteins comprise a family of homeodomain-containing transcription factors involved in patterning and regionalization of embryonic tissues in both vertebrates and invertebrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors