ISCA2 antibody (70R-2471)

Rabbit polyclonal ISCA2 antibody

Synonyms Polyclonal ISCA2 antibody, Anti-ISCA2 antibody, HBLD1 antibody, ISCA-2 antibody, ISCA-2, ISCA2, ISCA 2 antibody, Iron-Sulfur Cluster Assembly 2 Homolog antibody, ISCA 2, c14_5557 antibody, ISA2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ISCA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY
Assay Information ISCA2 Blocking Peptide, catalog no. 33R-8133, is also available for use as a blocking control in assays to test for specificity of this ISCA2 antibody

Images

Western Blot analysis using ISCA2 antibody (70R-2471)

ISCA2 antibody (70R-2471) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ISCA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ISCA2 antibody (70R-2471) | ISCA2 antibody (70R-2471) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors