ISG20 antibody (70R-4698)

Rabbit polyclonal ISG20 antibody raised against the middle region of ISG20

Synonyms Polyclonal ISG20 antibody, Anti-ISG20 antibody, HEM45 antibody, ISG20, CD25 antibody, Interferon Stimulated Exonuclease Gene 20Kda antibody, ISG-20 antibody, ISG 20 antibody, ISG-20, ISG 20
Specificity ISG20 antibody was raised against the middle region of ISG20
Cross Reactivity Human
Applications WB
Immunogen ISG20 antibody was raised using the middle region of ISG20 corresponding to a region with amino acids TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM
Assay Information ISG20 Blocking Peptide, catalog no. 33R-9301, is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody


Western Blot analysis using ISG20 antibody (70R-4698)

ISG20 antibody (70R-4698) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ISG20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ISG20 antibody (70R-4698) | ISG20 antibody (70R-4698) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors