ITFG3 antibody (70R-6769)

Rabbit polyclonal ITFG3 antibody raised against the middle region of ITFG3

Synonyms Polyclonal ITFG3 antibody, Anti-ITFG3 antibody, gs19 antibody, Integrin Alpha Fg-Gap Repeat Containing 3 antibody, ITFG-3, gene +108 antibody, DKFZP761D0211 antibody, ITFG3, ITFG-3 antibody, ITFG 3 antibody, FLJ32603 antibody, ITFG 3, C16orf9 antibody
Specificity ITFG3 antibody was raised against the middle region of ITFG3
Cross Reactivity Human
Applications WB
Immunogen ITFG3 antibody was raised using the middle region of ITFG3 corresponding to a region with amino acids RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA
Assay Information ITFG3 Blocking Peptide, catalog no. 33R-8171, is also available for use as a blocking control in assays to test for specificity of this ITFG3 antibody


Western Blot analysis using ITFG3 antibody (70R-6769)

ITFG3 antibody (70R-6769) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITFG3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ITFG3 is an integral membrane protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ITFG3 antibody (70R-6769) | ITFG3 antibody (70R-6769) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors