Itgb1 Blocking Peptide (33R-7017)

A synthetic peptide for use as a blocking control in assays to test for specificity of Itgb1 antibody, catalog no. 70R-9607

Synonyms Itgb1 control peptide, Itgb1 antibody Blocking Peptide, Anti-Itgb1 Blocking Peptide, integrin beta 1, fibronectin receptor beta Blocking Peptide, 4633401G24Rik Blocking Peptide, AA409975 Blocking Peptide, AA960159 Blocking Peptide, CD29 Blocking Peptide, Fnrb Blocking Peptide, gpIIa Blocking Peptide, Itgb1, Itgb-1, Itgb 1, Itgb-1 Blocking Peptide, Itgb 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD
Molecular Weight 86 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Itgb1 plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors