Itgb1 Blocking Peptide (33R-7017)
A synthetic peptide for use as a blocking control in assays to test for specificity of Itgb1 antibody, catalog no. 70R-9607
Overview
Overview
| Synonyms | Itgb1 control peptide, Itgb1 antibody Blocking Peptide, Anti-Itgb1 Blocking Peptide, integrin beta 1, fibronectin receptor beta Blocking Peptide, 4633401G24Rik Blocking Peptide, AA409975 Blocking Peptide, AA960159 Blocking Peptide, CD29 Blocking Peptide, Fnrb Blocking Peptide, gpIIa Blocking Peptide, Itgb1, Itgb-1, Itgb 1, Itgb-1 Blocking Peptide, Itgb 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD |
|---|---|
| Molecular Weight | 86 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Itgb1 plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product