ITGB1BP3 Blocking Peptide (33R-10154)
A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB1BP3 antibody, catalog no. 70R-2141
Overview
Overview
| Synonyms | ITGB1BP3 control peptide, ITGB1BP3 antibody Blocking Peptide, Anti-ITGB1BP3 Blocking Peptide, Integrin Beta 1 Binding Protein 3 Blocking Peptide, MGC126624 Blocking Peptide, MIBP Blocking Peptide, NRK2 Blocking Peptide, ITGB1BP3, ITGBBP3-1, ITGBBP3 1, ITGBBP3-1 Blocking Peptide, ITGBBP3 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product