ITGB1BP3 Blocking Peptide (33R-10154)

A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB1BP3 antibody, catalog no. 70R-2141

Synonyms ITGB1BP3 control peptide, ITGB1BP3 antibody Blocking Peptide, Anti-ITGB1BP3 Blocking Peptide, Integrin Beta 1 Binding Protein 3 Blocking Peptide, MGC126624 Blocking Peptide, MIBP Blocking Peptide, NRK2 Blocking Peptide, ITGB1BP3, ITGBBP3-1, ITGBBP3 1, ITGBBP3-1 Blocking Peptide, ITGBBP3 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors