ITGBL1 antibody (70R-1699)

Rabbit polyclonal ITGBL1 antibody

Synonyms Polyclonal ITGBL1 antibody, Anti-ITGBL1 antibody, ITGBL 1, ITGBL-1 antibody, Integrin Beta-Like 1 antibody, ITGBL-1, ITGBL1, TIED antibody, OSCP antibody, ITGBL 1 antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR
Assay Information ITGBL1 Blocking Peptide, catalog no. 33R-6373, is also available for use as a blocking control in assays to test for specificity of this ITGBL1 antibody


Western Blot analysis using ITGBL1 antibody (70R-1699)

ITGBL1 antibody (70R-1699) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ITGBL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ITGBL1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ITGBL1 antibody (70R-1699) | ITGBL1 antibody (70R-1699) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors