ITLN1 Blocking Peptide (33R-10022)
A synthetic peptide for use as a blocking control in assays to test for specificity of ITLN1 antibody, catalog no. 70R-8512
Overview
Overview
| Synonyms | ITLN1 control peptide, ITLN1 antibody Blocking Peptide, Anti-ITLN1 Blocking Peptide, intelectin 1, galactofuranose binding Blocking Peptide, FLJ20022 Blocking Peptide, HL-1 Blocking Peptide, HL1 Blocking Peptide, INTL Blocking Peptide, ITLN Blocking Peptide, LFR Blocking Peptide, hIntL Blocking Peptide, omentin Blocking Peptide, ITLN1, ITLN-1, ITLN 1, ITLN-1 Blocking Peptide, ITLN 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ITLN1 has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes.ITLN1 increases AKT phosphorylation in the absence and presence of insulin. ITLN1 may play a role in the defense system against microorganisms. ITLN1 may specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosyl residues, in a calcium-dependent manner. ITLN1 may be involved in iron metabolism. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product