JAK3 antibody (70R-5747)

Rabbit polyclonal JAK3 antibody

Synonyms Polyclonal JAK3 antibody, Anti-JAK3 antibody, Janus Kinase 3 antibody, JAKL antibody, JAK-3 antibody, L-JAK antibody, JAK3_HUMAN antibody, LJAK antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen JAK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF
Assay Information JAK3 Blocking Peptide, catalog no. 33R-4519, is also available for use as a blocking control in assays to test for specificity of this JAK3 antibody


Western Blot analysis using JAK3 antibody (70R-5747)

JAK3 antibody (70R-5747) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 125 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance JAK3 is a member of the Janus kinase (JAK) family of tyrosine kinases, which is involved in cytokine receptor-mediated intracellular signal transduction. JAK3 is predominantly expressed in immune cells and transduces a signal in response to its activation via tyrosine phosphorylation by interleukin receptors. Mutations in JAK3 are associated with autosomal SCID (severe combined immunodeficiency disease).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using JAK3 antibody (70R-5747) | JAK3 antibody (70R-5747) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors