JHDM1D antibody (70R-2404)

Rabbit polyclonal JHDM1D antibody

Synonyms Polyclonal JHDM1D antibody, Anti-JHDM1D antibody, Jumonji C Domain Containing Histone Demethylase 1 Homolog D antibody, KIAA1718 antibody
Cross Reactivity Human
Applications WB
Immunogen JHDM1D antibody was raised using a synthetic peptide corresponding to a region with amino acids LDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDI
Assay Information JHDM1D Blocking Peptide, catalog no. 33R-4837, is also available for use as a blocking control in assays to test for specificity of this JHDM1D antibody


Western Blot analysis using JHDM1D antibody (70R-2404)

JHDM1D antibody (70R-2404) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 106 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JHDM1D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance JHDM1D belongs to the JHDM1 histone demethylase family. It contains 1 JmjC domain and 1 PHD-type zinc finger. The function of JHDM1D remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using JHDM1D antibody (70R-2404) | JHDM1D antibody (70R-2404) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors