JMJD2B antibody (70R-2723)

Rabbit polyclonal JMJD2B antibody raised against the middle region of JMJD2B

Synonyms Polyclonal JMJD2B antibody, Anti-JMJD2B antibody, Jumonji Domain Containing 2B antibody, FLJ44906 antibody, KDM4B antibody, KIAA0876 antibody
Specificity JMJD2B antibody was raised against the middle region of JMJD2B
Cross Reactivity Human
Applications WB
Immunogen JMJD2B antibody was raised using the middle region of JMJD2B corresponding to a region with amino acids DQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIK
Assay Information JMJD2B Blocking Peptide, catalog no. 33R-2124, is also available for use as a blocking control in assays to test for specificity of this JMJD2B antibody

Images

Western blot analysis using JMJD2B antibody (70R-2723)

Recommended JMJD2B Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 122 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JMJD2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using JMJD2B antibody (70R-2723) | Recommended JMJD2B Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors