Jph2 Blocking Peptide (33R-10384)

A synthetic peptide for use as a blocking control in assays to test for specificity of Jph2 antibody, catalog no. 70R-8815

Synonyms Jph2 control peptide, Jph2 antibody Blocking Peptide, Anti-Jph2 Blocking Peptide, junctophilin 2 Blocking Peptide, 1110002E14Rik Blocking Peptide, JP-2 Blocking Peptide, Jp2 Blocking Peptide, Jph2, Jph-2, Jph 2, Jph-2 Blocking Peptide, Jph 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQ
Molecular Weight 75 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Jph2 contributes to the stabilization of the junctional membrane complexes, which are common to excitable cells and mediate cross-talk between cell surface and intracellular ion channels. It probably acts by anchoring the plasma membrane and endoplasmic/sarcoplasmic reticulum. Contributes to the construction of skeletal muscle triad junctions, and plays an essential role in heart development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors