KAP11.1 Blocking Peptide (33R-8433)

A synthetic peptide for use as a blocking control in assays to test for specificity of KRTAP11-1 antibody, catalog no. 70R-3239

Synonyms KAP11.1 control peptide, KAP11.1 antibody Blocking Peptide, Anti-KAP11.1 Blocking Peptide, Keratin Associated Protein 11-1 Blocking Peptide, KRTAP11-1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW
Molecular Weight 17 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KRTAP11-1 belongs to the PMG family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors