KAP11.1 Blocking Peptide (33R-8433)
A synthetic peptide for use as a blocking control in assays to test for specificity of KRTAP11-1 antibody, catalog no. 70R-3239
Overview
Overview
| Synonyms | KAP11.1 control peptide, KAP11.1 antibody Blocking Peptide, Anti-KAP11.1 Blocking Peptide, Keratin Associated Protein 11-1 Blocking Peptide, KRTAP11-1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW |
|---|---|
| Molecular Weight | 17 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | KRTAP11-1 belongs to the PMG family. In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product