KARS antibody (70R-4755)

Rabbit polyclonal KARS antibody raised against the C terminal of KARS

Synonyms Polyclonal KARS antibody, Anti-KARS antibody, Lysyl-tRNA Synthetase antibody
Specificity KARS antibody was raised against the C terminal of KARS
Cross Reactivity Human
Applications IHC, WB
Immunogen KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
Assay Information KARS Blocking Peptide, catalog no. 33R-3434, is also available for use as a blocking control in assays to test for specificity of this KARS antibody

Images

Immunohistochemical staining using KARS antibody (70R-4755)

KARS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KARS antibody (70R-4755) | KARS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using KARS antibody (70R-4755) | KARS antibody (70R-4755) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors