Karyopherin Alpha 1 antibody (70R-2363)

Rabbit polyclonal Karyopherin Alpha 1 antibody

Synonyms Polyclonal Karyopherin Alpha 1 antibody, Anti-Karyopherin Alpha 1 antibody, KPNA1 antibody, IPOA5 antibody, RCH2 antibody, NPI-1 antibody, Karyopherin Alpha 1, Karyopherin Alpha -1 antibody, Karyopherin Alpha -1, SRP1 antibody, Importin Alpha 5 antibody, Karyopherin Alpha 1 antibody, Karyopherin Alpha 1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA
Assay Information Karyopherin Alpha 1 Blocking Peptide, catalog no. 33R-9327, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 1 antibody


Western Blot analysis using Karyopherin Alpha 1 antibody (70R-2363)

Karyopherin Alpha 1 antibody (70R-2363) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KPNA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. KPNA1 interacts with RAG1 and may play a role in V(D)J recombination.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Karyopherin Alpha 1 antibody (70R-2363) | Karyopherin Alpha 1 antibody (70R-2363) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors