Karyopherin Alpha 1 Blocking Peptide (33R-9327)
A synthetic peptide for use as a blocking control in assays to test for specificity of KPNA1 antibody, catalog no. 70R-2363
Overview
Overview
| Synonyms | Karyopherin Alpha 1 control peptide, Karyopherin Alpha 1 antibody Blocking Peptide, Anti-Karyopherin Alpha 1 Blocking Peptide, IPOA5 Blocking Peptide, NPI-1 Blocking Peptide, RCH2 Blocking Peptide, SRP1 Blocking Peptide, Importin Alpha 5 Blocking Peptide, KPNA1 Blocking Peptide, Karyopherin Alpha 1, Karyopherin Alpha -1, Karyopherin Alpha 1, Karyopherin Alpha -1 Blocking Peptide, Karyopherin Alpha 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA |
|---|---|
| Molecular Weight | 60 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. KPNA1 interacts with RAG1 and may play a role in V(D)J recombination. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product