Karyopherin Alpha 1 Blocking Peptide (33R-9327)

A synthetic peptide for use as a blocking control in assays to test for specificity of KPNA1 antibody, catalog no. 70R-2363

Synonyms Karyopherin Alpha 1 control peptide, Karyopherin Alpha 1 antibody Blocking Peptide, Anti-Karyopherin Alpha 1 Blocking Peptide, IPOA5 Blocking Peptide, NPI-1 Blocking Peptide, RCH2 Blocking Peptide, SRP1 Blocking Peptide, Importin Alpha 5 Blocking Peptide, KPNA1 Blocking Peptide, Karyopherin Alpha 1, Karyopherin Alpha -1, Karyopherin Alpha 1, Karyopherin Alpha -1 Blocking Peptide, Karyopherin Alpha 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA
Molecular Weight 60 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. KPNA1 interacts with RAG1 and may play a role in V(D)J recombination.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors