Karyopherin Alpha 5 antibody (70R-2092)

Rabbit polyclonal Karyopherin Alpha 5 antibody

Synonyms Polyclonal Karyopherin Alpha 5 antibody, Anti-Karyopherin Alpha 5 antibody, SRP6 antibody, Importin Alpha 6 antibody, Karyopherin Alpha -5 antibody, Karyopherin Alpha 5, Karyopherin Alpha 5 antibody, Karyopherin Alpha 5, IPOA6 antibody, KPNA5 antibody, Karyopherin Alpha -5
Cross Reactivity Human
Applications WB
Immunogen Karyopherin Alpha 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE
Assay Information Karyopherin Alpha 5 Blocking Peptide, catalog no. 33R-9366, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 5 antibody

Images

Western Blot analysis using Karyopherin Alpha 5 antibody (70R-2092)

Karyopherin Alpha 5 antibody (70R-2092) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KPNA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Karyopherin Alpha 5 antibody (70R-2092) | Karyopherin Alpha 5 antibody (70R-2092) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors