Karyopherin Alpha 6 Blocking Peptide (33R-8891)

A synthetic peptide for use as a blocking control in assays to test for specificity of KPNA6 antibody, catalog no. 70R-2070

Synonyms Karyopherin Alpha 6 control peptide, Karyopherin Alpha 6 antibody Blocking Peptide, Anti-Karyopherin Alpha 6 Blocking Peptide, Importin Alpha 7 Blocking Peptide, FLJ11249 Blocking Peptide, IPOA7 Blocking Peptide, KPNA7 Blocking Peptide, MGC17918 Blocking Peptide, KPNA6 Blocking Peptide, Karyopherin Alpha 6, Karyopherin Alpha -6, Karyopherin Alpha 6, Karyopherin Alpha -6 Blocking Peptide, Karyopherin Alpha 6 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP
Molecular Weight 60 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. KPNA6 is a member of the importin alpha family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors