Karyopherin Alpha 6 Blocking Peptide (33R-8891)
A synthetic peptide for use as a blocking control in assays to test for specificity of KPNA6 antibody, catalog no. 70R-2070
Overview
Overview
| Synonyms | Karyopherin Alpha 6 control peptide, Karyopherin Alpha 6 antibody Blocking Peptide, Anti-Karyopherin Alpha 6 Blocking Peptide, Importin Alpha 7 Blocking Peptide, FLJ11249 Blocking Peptide, IPOA7 Blocking Peptide, KPNA7 Blocking Peptide, MGC17918 Blocking Peptide, KPNA6 Blocking Peptide, Karyopherin Alpha 6, Karyopherin Alpha -6, Karyopherin Alpha 6, Karyopherin Alpha -6 Blocking Peptide, Karyopherin Alpha 6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP |
|---|---|
| Molecular Weight | 60 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. KPNA6 is a member of the importin alpha family. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product