KBTBD10 Blocking Peptide (33R-5874)

A synthetic peptide for use as a blocking control in assays to test for specificity of KBTBD10 antibody, catalog no. 20R-1205

Synonyms KBTBD10 control peptide, KBTBD10 antibody Blocking Peptide, Anti-KBTBD10 Blocking Peptide, kelch repeat and BTB, POZ domain containing 10 Blocking Peptide, KBTBD10, KBTBD-10, KBTBD 10, KBTBD-10 Blocking Peptide, KBTBD 10 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLI
Molecular Weight 68 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KBTBD10 contains 1 BTB (POZ) domain and is required for pseudopod elongation in transformed cells. KBTBD10 mRNA is up-regulated by less than two folds in the heart in human patients with HCM.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors