KBTBD10 Blocking Peptide (33R-5874)
A synthetic peptide for use as a blocking control in assays to test for specificity of KBTBD10 antibody, catalog no. 20R-1205
Overview
Overview
| Synonyms | KBTBD10 control peptide, KBTBD10 antibody Blocking Peptide, Anti-KBTBD10 Blocking Peptide, kelch repeat and BTB, POZ domain containing 10 Blocking Peptide, KBTBD10, KBTBD-10, KBTBD 10, KBTBD-10 Blocking Peptide, KBTBD 10 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLI |
|---|---|
| Molecular Weight | 68 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | KBTBD10 contains 1 BTB (POZ) domain and is required for pseudopod elongation in transformed cells. KBTBD10 mRNA is up-regulated by less than two folds in the heart in human patients with HCM. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product