KCNA7 antibody (70R-5117)

Rabbit polyclonal KCNA7 antibody raised against the C terminal of KCNA7

Synonyms Polyclonal KCNA7 antibody, Anti-KCNA7 antibody, KCNA 7, Potassium Voltage-Gated Channel Shaker-Related Subfamily Member 7 antibody, KCNA-7, KCNA 7 antibody, KCNA7, KCNA-7 antibody
Specificity KCNA7 antibody was raised against the C terminal of KCNA7
Cross Reactivity Human
Applications WB
Immunogen KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV
Assay Information KCNA7 Blocking Peptide, catalog no. 33R-3222, is also available for use as a blocking control in assays to test for specificity of this KCNA7 antibody

Images

Western Blot analysis using KCNA7 antibody (70R-5117)

KCNA7 antibody (70R-5117) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNA7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNA7 antibody (70R-5117) | KCNA7 antibody (70R-5117) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors