KCNAB1 antibody (70R-5041)

Rabbit polyclonal KCNAB1 antibody raised against the C terminal of KCNAB1

Synonyms Polyclonal KCNAB1 antibody, Anti-KCNAB1 antibody, KCNAB-1, KCNAB-1 antibody, Potassium Voltage-Gated Channel Shaker-Related Subfamily Beta Member 1 antibody, KCNAB1, KCNAB 1 antibody, KCNAB 1
Specificity KCNAB1 antibody was raised against the C terminal of KCNAB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNAB1 antibody was raised using the C terminal of KCNAB1 corresponding to a region with amino acids VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV
Assay Information KCNAB1 Blocking Peptide, catalog no. 33R-9721, is also available for use as a blocking control in assays to test for specificity of this KCNAB1 antibody

Images

Western Blot analysis using KCNAB1 antibody (70R-5041)

KCNAB1 antibody (70R-5041) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNAB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNAB1 antibody (70R-5041) | KCNAB1 antibody (70R-5041) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors