KCNAB2 antibody (70R-1486)

Rabbit polyclonal KCNAB2 antibody raised against the middle region of KCNAB2

Synonyms Polyclonal KCNAB2 antibody, Anti-KCNAB2 antibody, KCNAB-2, Potassium Voltage-Gated Channel Shaker-Related Subfamily Beta Member 2 antibody, KCNAB2, KCNAB 2, KCNAB 2 antibody, KCNAB-2 antibody
Specificity KCNAB2 antibody was raised against the middle region of KCNAB2
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
Assay Information KCNAB2 Blocking Peptide, catalog no. 33R-9950, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody


Immunohistochemical staining using KCNAB2 antibody (70R-1486)

KCNAB2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNAB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KCNAB2 antibody (70R-1486) | KCNAB2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using KCNAB2 antibody (70R-1486) | KCNAB2 antibody (70R-1486) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors