KCNB1 antibody (70R-5114)

Rabbit polyclonal KCNB1 antibody raised against the middle region of KCNB1

Synonyms Polyclonal KCNB1 antibody, Anti-KCNB1 antibody, DRK1 antibody, KCNB1, KCNB 1 antibody, h-DRK1 antibody, KCNB-1, KCNB 1, KCNB-1 antibody, Potassium Voltage-Gated Channel Shab-Related Subfamily Member 1 antibody, KV2.1 antibody
Specificity KCNB1 antibody was raised against the middle region of KCNB1
Cross Reactivity Human
Applications WB
Immunogen KCNB1 antibody was raised using the middle region of KCNB1 corresponding to a region with amino acids YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT
Assay Information KCNB1 Blocking Peptide, catalog no. 33R-10132, is also available for use as a blocking control in assays to test for specificity of this KCNB1 antibody

Images

Western Blot analysis using KCNB1 antibody (70R-5114)

KCNB1 antibody (70R-5114) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNB1 antibody (70R-5114) | KCNB1 antibody (70R-5114) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors