KCNC1 antibody (70R-1810)

Rabbit polyclonal KCNC1 antibody raised against the N terminal of KCNC1

Synonyms Polyclonal KCNC1 antibody, Anti-KCNC1 antibody, KCNC-1, NGK2 antibody, KCNC-1 antibody, MGC129855 antibody, KV4 antibody, KV3.1 antibody, KCNC 1 antibody, KCNC1, Potassium Voltage-Gated Channel Shaw-Related Subfamily Member 1 antibody, KCNC 1
Specificity KCNC1 antibody was raised against the N terminal of KCNC1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
Assay Information KCNC1 Blocking Peptide, catalog no. 33R-9400, is also available for use as a blocking control in assays to test for specificity of this KCNC1 antibody

Images

Western Blot analysis using KCNC1 antibody (70R-1810)

KCNC1 antibody (70R-1810) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNC1 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNC1 antibody (70R-1810) | KCNC1 antibody (70R-1810) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors