KCNG4 antibody (70R-5178)

Rabbit polyclonal KCNG4 antibody raised against the N terminal of KCNG4

Synonyms Polyclonal KCNG4 antibody, Anti-KCNG4 antibody, MGC129609 antibody, KV6.4 antibody, KCNG-4, Potassium Voltage-Gated Channel Subfamily G Member 4 antibody, KV6.3 antibody, MGC4558 antibody, KCNG-4 antibody, KCNG 4 antibody, KCNG 4, KCNG4
Specificity KCNG4 antibody was raised against the N terminal of KCNG4
Cross Reactivity Human
Applications WB
Immunogen KCNG4 antibody was raised using the N terminal of KCNG4 corresponding to a region with amino acids QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP
Assay Information KCNG4 Blocking Peptide, catalog no. 33R-7518, is also available for use as a blocking control in assays to test for specificity of this KCNG4 antibody

Images

Western Blot analysis using KCNG4 antibody (70R-5178)

KCNG4 antibody (70R-5178) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNG4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG4 is a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The protein has strong expression in brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNG4 antibody (70R-5178) | KCNG4 antibody (70R-5178) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors