KCNH3 antibody (70R-5167)

Rabbit polyclonal KCNH3 antibody

Synonyms Polyclonal KCNH3 antibody, Anti-KCNH3 antibody, KCNH-3, Potassium Voltage-Gated Channel Subfamily H antibody, Kv12.2 antibody, KIAA1282 antibody, KCNH3, BEC1 antibody, KCNH 3, KCNH-3 antibody, ELK2 antibody, KCNH 3 antibody, Eag-Related 3 antibody
Cross Reactivity Human
Applications WB
Immunogen KCNH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLL
Assay Information KCNH3 Blocking Peptide, catalog no. 33R-8449, is also available for use as a blocking control in assays to test for specificity of this KCNH3 antibody

Images

Western Blot analysis using KCNH3 antibody (70R-5167)

KCNH3 antibody (70R-5167) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 117 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNH3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KCNH3 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNH3 antibody (70R-5167) | KCNH3 antibody (70R-5167) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors