KCNH5 antibody (70R-5121)

Rabbit polyclonal KCNH5 antibody

Synonyms Polyclonal KCNH5 antibody, Anti-KCNH5 antibody, KCNH5, Eag-Related 5 antibody, KCNH-5 antibody, KCNH 5 antibody, KCNH-5, KCNH 5, Potassium Voltage-Gated Channel Subfamily H antibody
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH
Assay Information KCNH5 Blocking Peptide, catalog no. 33R-5485, is also available for use as a blocking control in assays to test for specificity of this KCNH5 antibody

Images

Immunohistochemical staining using KCNH5 antibody (70R-5121)

KCNH5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNH5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNH5 gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. KCNH5 is not expressed in differentiating myoblasts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KCNH5 antibody (70R-5121) | KCNH5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X
  • Western Blot analysis using KCNH5 antibody (70R-5121) | KCNH5 antibody (70R-5121) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors