KCNJ12 antibody (70R-5160)

Rabbit polyclonal KCNJ12 antibody raised against the middle region of KCNJ12

Synonyms Polyclonal KCNJ12 antibody, Anti-KCNJ12 antibody, IRK2 antibody, Potassium Inwardly-Rectifying Channel Subfamily J Member 12 antibody, KCNJ12, Kir2.2 antibody, Kir2.2v antibody, hIRK antibody, hIRK1 antibody, KCNJ-12, KCNJ 12 antibody, KCNJ 12, KCNJ-12 antibody, hkir2.2x antibody, KCNJN1 antibody, kcnj12x antibody, FLJ14167 antibody
Specificity KCNJ12 antibody was raised against the middle region of KCNJ12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNJ12 antibody was raised using the middle region of KCNJ12 corresponding to a region with amino acids KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR
Assay Information KCNJ12 Blocking Peptide, catalog no. 33R-4295, is also available for use as a blocking control in assays to test for specificity of this KCNJ12 antibody

Images

Western Blot analysis using KCNJ12 antibody (70R-5160)

KCNJ12 antibody (70R-5160) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNJ12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNJ12 is an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). This gene is located within the Smith-Magenis syndrome region on chromosome 17.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNJ12 antibody (70R-5160) | KCNJ12 antibody (70R-5160) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors