KCNJ9 antibody (70R-5156)

Rabbit polyclonal KCNJ9 antibody raised against the middle region of KCNJ9

Synonyms Polyclonal KCNJ9 antibody, Anti-KCNJ9 antibody, Potassium Inwardly-Rectifying Channel Subfamily J Member 9 antibody, GIRK3 antibody, KCNJ-9, KCNJ 9, KCNJ9, KCNJ-9 antibody, KIR3.3 antibody, KCNJ 9 antibody
Specificity KCNJ9 antibody was raised against the middle region of KCNJ9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNJ9 antibody was raised using the middle region of KCNJ9 corresponding to a region with amino acids CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR
Assay Information KCNJ9 Blocking Peptide, catalog no. 33R-1778, is also available for use as a blocking control in assays to test for specificity of this KCNJ9 antibody


Western Blot analysis using KCNJ9 antibody (70R-5156)

KCNJ9 antibody (70R-5156) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNJ9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNJ9 antibody (70R-5156) | KCNJ9 antibody (70R-5156) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors