KCNK13 antibody (70R-1538)

Rabbit polyclonal KCNK13 antibody raised against the C terminal of KCNK13

Synonyms Polyclonal KCNK13 antibody, Anti-KCNK13 antibody, KCNK 13 antibody, KCNK-13 antibody, KCNK-13, Potassium Channel Subfamily K Member 13 antibody, KCNK13, KCNK 13
Specificity KCNK13 antibody was raised against the C terminal of KCNK13
Cross Reactivity Human
Applications WB
Immunogen KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM
Assay Information KCNK13 Blocking Peptide, catalog no. 33R-8639, is also available for use as a blocking control in assays to test for specificity of this KCNK13 antibody

Images

Western Blot analysis using KCNK13 antibody (70R-1538)

KCNK13 antibody (70R-1538) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNK13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of KCNK13 is an open channel that can be stimulated by arachidonic acid.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNK13 antibody (70R-1538) | KCNK13 antibody (70R-1538) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors