KCNK3 antibody (70R-1536)

Rabbit polyclonal KCNK3 antibody raised against the C terminal of KCNK3

Synonyms Polyclonal KCNK3 antibody, Anti-KCNK3 antibody, Potassium Channel Subfamily K Member 3 antibody, KCNK3, KCNK-3 antibody, KCNK-3, KCNK 3 antibody, KCNK 3
Specificity KCNK3 antibody was raised against the C terminal of KCNK3
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen KCNK3 antibody was raised using the C terminal of KCNK3 corresponding to a region with amino acids TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
Assay Information KCNK3 Blocking Peptide, catalog no. 33R-9002, is also available for use as a blocking control in assays to test for specificity of this KCNK3 antibody

Images

Western Blot analysis using KCNK3 antibody (70R-1536)

KCNK3 antibody (70R-1536) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNK3 antibody (70R-1536) | KCNK3 antibody (70R-1536) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors