KCNK5 antibody (70R-5224)

Rabbit polyclonal KCNK5 antibody raised against the C terminal of KCNK5

Synonyms Polyclonal KCNK5 antibody, Anti-KCNK5 antibody, KCNK-5, KCNK 5 antibody, KCNK 5, Potassium Channel Subfamily K Member 5 antibody, KCNK-5 antibody, KCNK5
Specificity KCNK5 antibody was raised against the C terminal of KCNK5
Cross Reactivity Human
Applications WB
Immunogen KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES
Assay Information KCNK5 Blocking Peptide, catalog no. 33R-9078, is also available for use as a blocking control in assays to test for specificity of this KCNK5 antibody


Western Blot analysis using KCNK5 antibody (70R-5224)

KCNK5 antibody (70R-5224) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNK5 antibody (70R-5224) | KCNK5 antibody (70R-5224) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors