KCNK6 antibody (70R-5203)

Rabbit polyclonal KCNK6 antibody raised against the n terminal of KCNK6

Synonyms Polyclonal KCNK6 antibody, Anti-KCNK6 antibody, K2p6.1 antibody, TOSS antibody, KCNK6, KCNK 6 antibody, KCNK-6, TWIK2 antibody, FLJ12282 antibody, KCNK 6, KCNK8 antibody, TWIK-2 antibody, KCNK-6 antibody, Potassium Channel Subfamily K Member 6 antibody
Specificity KCNK6 antibody was raised against the n terminal of KCNK6
Cross Reactivity Human
Applications WB
Immunogen KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
Assay Information KCNK6 Blocking Peptide, catalog no. 33R-8027, is also available for use as a blocking control in assays to test for specificity of this KCNK6 antibody


Western Blot analysis using KCNK6 antibody (70R-5203)

KCNK6 antibody (70R-5203) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK6 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNK6 antibody (70R-5203) | KCNK6 antibody (70R-5203) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors