KCNK9 antibody (70R-5199)

Rabbit polyclonal KCNK9 antibody raised against the N terminal of KCNK9

Synonyms Polyclonal KCNK9 antibody, Anti-KCNK9 antibody, KCNK 9 antibody, KT3.2 antibody, TASK3 antibody, KCNK-9, K2p9.1 antibody, Potassium Channel Subfamily K Member 9 antibody, TASK-3 antibody, KCNK 9, MGC138268 antibody, KCNK-9 antibody, MGC138270 antibody, KCNK9
Specificity KCNK9 antibody was raised against the N terminal of KCNK9
Cross Reactivity Human
Applications WB
Immunogen KCNK9 antibody was raised using the N terminal of KCNK9 corresponding to a region with amino acids REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY
Assay Information KCNK9 Blocking Peptide, catalog no. 33R-7869, is also available for use as a blocking control in assays to test for specificity of this KCNK9 antibody


Immunohistochemical staining using KCNK9 antibody (70R-5199)

KCNK9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK9 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This open channel is highly expressed in the cerebellum. It is inhibited by extracellular acidification and arachidonic acid, and strongly inhibited by phorbol 12-myristate 13-acetate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KCNK9 antibody (70R-5199) | KCNK9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using KCNK9 antibody (70R-5199) | KCNK9 antibody (70R-5199) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors