KCNMB3 antibody (70R-5170)

Rabbit polyclonal KCNMB3 antibody raised against the middle region of KCNMB3

Synonyms Polyclonal KCNMB3 antibody, Anti-KCNMB3 antibody, KCNMB2 antibody, KCNMB3, KCNMBL antibody, KCNMB-3 antibody, KCNMB 3, KCNMB-3, Potassium Large Conductance Calcium-Activated Channel Subfamily M Beta Member 3 antibody, KCNMB 3 antibody
Specificity KCNMB3 antibody was raised against the middle region of KCNMB3
Cross Reactivity Human
Applications WB
Immunogen KCNMB3 antibody was raised using the middle region of KCNMB3 corresponding to a region with amino acids SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC
Assay Information KCNMB3 Blocking Peptide, catalog no. 33R-8629, is also available for use as a blocking control in assays to test for specificity of this KCNMB3 antibody

Images

Western Blot analysis using KCNMB3 antibody (70R-5170)

KCNMB3 antibody (70R-5170) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNMB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNMB3 is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. At least four transcript variants encoding four different isoforms have been found for KCNMB3.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNMB3 antibody (70R-5170) | KCNMB3 antibody (70R-5170) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors