KCNMB4 antibody (70R-5108)

Rabbit polyclonal KCNMB4 antibody raised against the middle region of KCNMB4

Synonyms Polyclonal KCNMB4 antibody, Anti-KCNMB4 antibody, KCNMB 4 antibody, KCNMB4, KCNMB-4, Potassium Large Conductance Calcium-Activated Channel Subfamily M Beta Member 4 antibody, KCNMB 4, KCNMB-4 antibody
Specificity KCNMB4 antibody was raised against the middle region of KCNMB4
Cross Reactivity Human
Applications WB
Immunogen KCNMB4 antibody was raised using the middle region of KCNMB4 corresponding to a region with amino acids TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
Assay Information KCNMB4 Blocking Peptide, catalog no. 33R-8994, is also available for use as a blocking control in assays to test for specificity of this KCNMB4 antibody

Images

Western Blot analysis using KCNMB4 antibody (70R-5108)

KCNMB4 antibody (70R-5108) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNMB4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNMB4 is the regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. KCNMB4 modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. KCNMB4 decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. KCNMB4 may decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. KCNMB4 makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNMB4 antibody (70R-5108) | KCNMB4 antibody (70R-5108) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors