KCNQ2 antibody (70R-1525)

Rabbit polyclonal KCNQ2 antibody raised against the middle region of KCNQ2

Synonyms Polyclonal KCNQ2 antibody, Anti-KCNQ2 antibody, KCNQ 2, KCNQ2, KCNQ 2 antibody, KCNQ-2 antibody, KCNQ-2, Potassium Voltage-Gated Channel Kqt-Like Subfamily Member 2 antibody
Specificity KCNQ2 antibody was raised against the middle region of KCNQ2
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
Assay Information KCNQ2 Blocking Peptide, catalog no. 33R-3461, is also available for use as a blocking control in assays to test for specificity of this KCNQ2 antibody


Immunohistochemical staining using KCNQ2 antibody (70R-1525)

KCNQ2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNQ2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KCNQ2 antibody (70R-1525) | KCNQ2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using KCNQ2 antibody (70R-1525) | KCNQ2 antibody (70R-1525) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors