KCNQ2 antibody (70R-5183)

Rabbit polyclonal KCNQ2 antibody raised against the middle region of KCNQ2

Synonyms Polyclonal KCNQ2 antibody, Anti-KCNQ2 antibody, KCNQ 2 antibody, KVEBN1 antibody, HNSPC antibody, EBN1 antibody, KV7.2 antibody, ENB1 antibody, KCNQ 2, Potassium Voltage-Gated Channel Kqt-Like Subfamily Member 2 antibody, KCNQ2, KCNQ-2, KCNA11 antibody, EBN antibody, BFNC antibody, KCNQ-2 antibody
Specificity KCNQ2 antibody was raised against the middle region of KCNQ2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH
Assay Information KCNQ2 Blocking Peptide, catalog no. 33R-8523, is also available for use as a blocking control in assays to test for specificity of this KCNQ2 antibody


Western Blot analysis using KCNQ2 antibody (70R-5183)

KCNQ2 antibody (70R-5183) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNQ2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by KCNQ2 and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNQ2 antibody (70R-5183) | KCNQ2 antibody (70R-5183) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors