KCNRG antibody (70R-5087)

Rabbit polyclonal KCNRG antibody raised against the middle region of KCNRG

Synonyms Polyclonal KCNRG antibody, Anti-KCNRG antibody, DLTET antibody, Potassium Channel Regulator antibody
Specificity KCNRG antibody was raised against the middle region of KCNRG
Cross Reactivity Human
Applications WB
Immunogen KCNRG antibody was raised using the middle region of KCNRG corresponding to a region with amino acids DTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIP
Assay Information KCNRG Blocking Peptide, catalog no. 33R-2198, is also available for use as a blocking control in assays to test for specificity of this KCNRG antibody


Western Blot analysis using KCNRG antibody (70R-5087)

KCNRG antibody (70R-5087) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNRG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNRG antibody (70R-5087) | KCNRG antibody (70R-5087) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors